3.12 Rating by CuteStat

scionxb.org is 2 decades 4 years old. It is a domain having org extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, scionxb.org is SAFE to browse.

PageSpeed Score
87
Siteadvisor Rating
No Risk Issues

Traffic Report

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: No Risk Issues
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: Not Applicable
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

64.151.192.52

Hosted Country:

Canada CA

Location Latitude:

43.6319

Location Longitude:

-79.3716

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: 1 H2 Headings: 1
H3 Headings: 1 H4 Headings: 2
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 1
Google Adsense: Not Applicable Google Analytics: UA-54838526-1

Websites Hosted on Same IP (i.e. 64.151.192.52)

403 Forbidden

- panamacitycriminallawdefense.com
Not Applicable $ 8.95

Navy League - Bay County, Florida

- navyleaguebay.com
Not Applicable $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Wed, 17 May 2017 01:04:43 GMT
Server: Apache
Last-Modified: Tue, 16 Sep 2014 05:59:54 GMT
Accept-Ranges: bytes
Vary: Accept-Encoding,User-Agent
Content-Encoding: gzip
Strict-Transport-Security: “max-age=31536000″
Content-Length: 2751
Connection: close
Content-Type: text/html

Domain Information

Domain Registrar: Tucows Domains Inc.
Registration Date: Feb 23, 2000, 12:00 AM 2 decades 4 years 2 months ago
Last Modified: Feb 6, 2016, 12:00 AM 8 years 3 months 6 days ago
Expiration Date: Feb 23, 2018, 12:00 AM 6 years 2 months 3 weeks ago
Domain Status:
ok

DNS Record Analysis

Host Type TTL Extra
scionxb.org A 14399 IP: 64.151.192.52
scionxb.org NS 86399 Target: ns2.micaspecialties.com
scionxb.org NS 86399 Target: ns1.micaspecialties.com
scionxb.org SOA 86399 MNAME: ns1.micaspecialties.com
RNAME: domainhelper.micaspecialties.com
Serial: 2015092000
Refresh: 86400
Retry: 7200
Expire: 3600000
Minimum TTL: 86400
scionxb.org MX 14399 Target: scionxb.org
scionxb.org TXT 14399 TXT: v=spf1 +a +mx +ip4:64.151.192.15 -all